PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_49.32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HSF
Protein Properties Length: 157aa    MW: 18057.7 Da    PI: 7.446
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_49.32genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind82.94.8e-262686262
                                 HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
                 HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
                                 Fl+k+y++++d+++++++sw e+ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y +
  evm.model.supercontig_49.32 26 FLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYVY 86
                                 9**********************************************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.104.0E-281886IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.3E-2722127IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467858.16E-252599IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000562.9E-162649IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004476.3E-222686IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.9E-166476IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.9E-167789IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MAALMLDNCE GILLSLDSHK SVPAPFLTKT YQLVDDPSTD HIVSWGEDDT TFVVWRPPEF  60
ARDLLPNYFK HNNFSSFVRQ LNTYVYYIYP PTYISSMLYI NSMALLIWVL CFWVVDGTRV  120
LGRLYLTDGS LQTSSSRRER SICCVRSTEG KQHSRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B2e-1621862589Heat shock factor protein 1
5d5v_B2e-1621862589Heat shock factor protein 1
5d5v_D2e-1621862589Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010112180.11e-53Heat stress transcription factor B-4
SwissprotQ7XHZ01e-41HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBLA0A068U1352e-54A0A068U135_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000205545e-53(Solanum tuberosum)
STRINGVIT_18s0001g10380.t015e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29002866
Representative plantOGRP9617233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.12e-40heat shock transcription factor B4